RMI1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB579757
| Artikelname: |
RMI1 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB579757 |
| Hersteller Artikelnummer: |
orb579757 |
| Alternativnummer: |
BYT-ORB579757-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human RMI1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
BLAP75, FAAP75, C9orf76 |
| Rabbit polyclonal antibody to RMI1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
70 kDa |
| NCBI: |
079221 |
| UniProt: |
Q9H9A7 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA |
| Target-Kategorie: |
RMI1 |
