NINL antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579758
Artikelname: NINL antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579758
Hersteller Artikelnummer: orb579758
Alternativnummer: BYT-ORB579758-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human NINL
Konjugation: Unconjugated
Alternative Synonym: NLP
Rabbit polyclonal antibody to NINL
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 156 kDa
UniProt: Q9Y2I6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: DLERAEKRNLEFVKEMDDCHSTLEQLTEKKIKHLEQGYRERLSLLRSEVE
Target-Kategorie: NINL