TARS antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579761
Artikelname: TARS antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579761
Hersteller Artikelnummer: orb579761
Alternativnummer: BYT-ORB579761-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TARS
Konjugation: Unconjugated
Alternative Synonym: TARS, TTD7, ThrRS
Rabbit polyclonal antibody to TARS
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 78kDa
NCBI: 88355
UniProt: Q5M7Z9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT
Target-Kategorie: TARS