DLK1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB579767
| Artikelname: |
DLK1 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB579767 |
| Hersteller Artikelnummer: |
orb579767 |
| Alternativnummer: |
BYT-ORB579767-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human DLK1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
DLK, FA1, ZOG, pG2, DLK-1, PREF1, Delta1, Pref-1 |
| Rabbit polyclonal antibody to DLK1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
41kDa |
| NCBI: |
003827 |
| UniProt: |
P80370 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT |
| Target-Kategorie: |
DLK1 |
