ST3GAL5 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579772
Artikelname: ST3GAL5 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579772
Hersteller Artikelnummer: orb579772
Alternativnummer: BYT-ORB579772-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ST3GAL5
Konjugation: Unconjugated
Alternative Synonym: SATI, SIAT9, SPDRS, ST3GalV, SIATGM3S, ST3Gal V
Rabbit polyclonal antibody to ST3GAL5
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 48kDa
NCBI: 003887
UniProt: Q6NZX4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
Target-Kategorie: ST3GAL5