Chst2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB579784
Artikelname: Chst2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB579784
Hersteller Artikelnummer: orb579784
Alternativnummer: BYT-ORB579784-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Gn6, GST-, Chts2, GST-2, Gn6st, AI428561, AW121776, GlcNAc6ST, C130041E03Rik
Rabbit polyclonal antibody to Chst2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 58kDa
NCBI: 061233
UniProt: Q80WV3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: VFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRV
Target-Kategorie: Chst2