Chst2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB579784
Artikelname: |
Chst2 antibody, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB579784 |
Hersteller Artikelnummer: |
orb579784 |
Alternativnummer: |
BYT-ORB579784-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Mouse |
Konjugation: |
Unconjugated |
Alternative Synonym: |
Gn6, GST-, Chts2, GST-2, Gn6st, AI428561, AW121776, GlcNAc6ST, C130041E03Rik |
Rabbit polyclonal antibody to Chst2 |
Klonalität: |
Polyclonal |
Konzentration: |
0.5 mg/ml |
Molekulargewicht: |
58kDa |
NCBI: |
061233 |
UniProt: |
Q80WV3 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequenz: |
Synthetic peptide located within the following region: VFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRV |
Target-Kategorie: |
Chst2 |