CCDC75 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587264
Artikelname: CCDC75 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587264
Hersteller Artikelnummer: orb587264
Alternativnummer: BYT-ORB587264-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC75
Konjugation: Unconjugated
Alternative Synonym: CENPY, CCDC75, CENP-Y
Rabbit polyclonal antibody to CCDC75
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 30kDa
NCBI: 777591
UniProt: Q8N954
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: DSFINVQEDIRPGLPMLRQIREARRKEEKQQEANLKNRQKSLKEEEQERR
Target-Kategorie: GPATCH11