PPIA antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587713
Artikelname: PPIA antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587713
Hersteller Artikelnummer: orb587713
Alternativnummer: BYT-ORB587713-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PPIA
Konjugation: Unconjugated
Alternative Synonym: CYPA, CYPH, HEL-S-69p
Rabbit polyclonal antibody to PPIA
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 18kDa
UniProt: P62937
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: NGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
Target-Kategorie: PPIA