PPTC7 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587715
Artikelname: PPTC7 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587715
Hersteller Artikelnummer: orb587715
Alternativnummer: BYT-ORB587715-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPTC7
Konjugation: Unconjugated
Alternative Synonym: TAPP2C, TA-PP2C
Rabbit polyclonal antibody to PPTC7
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 32kDa
NCBI: 644812
UniProt: Q8NI37
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACD
Target-Kategorie: PPTC7