CFI antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587721
Artikelname: CFI antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587721
Hersteller Artikelnummer: orb587721
Alternativnummer: BYT-ORB587721-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CFI
Konjugation: Unconjugated
Alternative Synonym: FI, IF, KAF, AHUS3, ARMD13, C3BINA, C3b-INA
Rabbit polyclonal antibody to CFI
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 64kDa
NCBI: 000195
UniProt: P05156
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: AGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYT
Target-Kategorie: CFI