PRSS42 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587722
Artikelname: PRSS42 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587722
Hersteller Artikelnummer: orb587722
Alternativnummer: BYT-ORB587722-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRSS42
Konjugation: Unconjugated
Alternative Synonym: PRSS42, TESSP2
Rabbit polyclonal antibody to PRSS42
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 32kDa
NCBI: 874361
UniProt: Q7Z5A4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: TSNIQPICIPQENFQVEGRTRCWVTGWGKTPEREKLASEILQDVDQYIMC
Target-Kategorie: PRSS42