PYROXD1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587730
Artikelname: PYROXD1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587730
Hersteller Artikelnummer: orb587730
Alternativnummer: BYT-ORB587730-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human PYROXD1
Konjugation: Unconjugated
Alternative Synonym: MFM8
Rabbit polyclonal antibody to PYROXD1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 47kDa
NCBI: 079130
UniProt: B3KWN8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: IESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKLICEGNPYVLGIR
Target-Kategorie: PYROXD1