SAMD10 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587743
Artikelname: SAMD10 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587743
Hersteller Artikelnummer: orb587743
Alternativnummer: BYT-ORB587743-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SAMD10
Konjugation: Unconjugated
Alternative Synonym: dJ591C20, C20orf136, dJ591C20.7
Rabbit polyclonal antibody to SAMD10
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 22kDa
NCBI: 542188
UniProt: Q9BYL1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: AHFSFCRTLLEHTVSAESIPCHLPRTPGTSLTWHDSRSQRAASSRPIKLL
Target-Kategorie: SAMD10