SFT2D2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587747
Artikelname: SFT2D2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587747
Hersteller Artikelnummer: orb587747
Alternativnummer: BYT-ORB587747-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SFT2D2
Konjugation: Unconjugated
Alternative Synonym: UNQ512, dJ747L4.C1.2
Rabbit polyclonal antibody to SFT2D2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 17kDa
NCBI: 955376
UniProt: O95562
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LKKVLSGQDTEDRSGLSEVVEASSLSWSTRIKGFIACFAIGILCSLLGTV
Target-Kategorie: SFT2D2