MIEF2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587751
Artikelname: MIEF2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587751
Hersteller Artikelnummer: orb587751
Alternativnummer: BYT-ORB587751-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SMCR7
Konjugation: Unconjugated
Alternative Synonym: MID49, SMCR7, COXPD49
Rabbit polyclonal antibody to MIEF2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 22kDa
UniProt: Q96C03
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: IDRATSPRDEDDTKADSWKELSLLKATPHLQPRPPPAALSQPVLPLAPSS
Target-Kategorie: MIEF2