SMCR8 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587752
Artikelname: SMCR8 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587752
Hersteller Artikelnummer: orb587752
Alternativnummer: BYT-ORB587752-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SMCR8
Konjugation: Unconjugated
Alternative Synonym: DENND8A
Rabbit polyclonal antibody to SMCR8
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 937kDa
UniProt: Q8TEV9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: STYYLHVQSMLTQLCSKAFLYTFCHHLHLPTHDKETEELVASRQMSFLKL
Target-Kategorie: SMCR8