TCTEX1D1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587767
Artikelname: TCTEX1D1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587767
Hersteller Artikelnummer: orb587767
Alternativnummer: BYT-ORB587767-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TCTEX1D1
Konjugation: Unconjugated
Alternative Synonym: TCTEX1D1
Rabbit polyclonal antibody to TCTEX1D1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 19kDa
NCBI: 689878
UniProt: Q8N7M0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: KKRGSISSLSNHEFWRKEIHGRIKDSMSTVSYMEEPSQRDDISRLTVQME
Target-Kategorie: TCTEX1D1