TELO2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587770
Artikelname: TELO2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587770
Hersteller Artikelnummer: orb587770
Alternativnummer: BYT-ORB587770-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TELO2
Konjugation: Unconjugated
Alternative Synonym: CLK2, TEL2, YHFS
Rabbit polyclonal antibody to TELO2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 92kDa
NCBI: 057195
UniProt: Q9Y4R8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LEDLMDELLEARSWLADVAEKDPDEDCRTLALRALLLLQRLKNRLLPPAS
Target-Kategorie: TELO2