THUMPD1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB587771
Artikelname: |
THUMPD1 antibody, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB587771 |
Hersteller Artikelnummer: |
orb587771 |
Alternativnummer: |
BYT-ORB587771-100 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of human THUMPD1 |
Konjugation: |
Unconjugated |
Alternative Synonym: |
Tan1 |
Rabbit polyclonal antibody to THUMPD1 |
Klonalität: |
Polyclonal |
Konzentration: |
0.5 mg/ml |
Molekulargewicht: |
48kDa |
NCBI: |
001291479 |
UniProt: |
Q9NXG2 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequenz: |
Synthetic peptide located within the following region: KNNQQVPENTEELGQTKPTSNPQVVNEGGAKPELASQATEGSKSNENDFS |
Target-Kategorie: |
THUMPD1 |