TMEM145 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587775
Artikelname: TMEM145 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587775
Hersteller Artikelnummer: orb587775
Alternativnummer: BYT-ORB587775-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMEM145
Konjugation: Unconjugated
Rabbit polyclonal antibody to TMEM145
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 54kDa
NCBI: 775904
UniProt: Q8NBT3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: DDPSQWPAVYKAGDKDCLAKESVIRPENNQVINLTTQYAWSGCQVVSEEG
Target-Kategorie: TMEM145