TMPRSS7 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587778
Artikelname: TMPRSS7 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587778
Hersteller Artikelnummer: orb587778
Alternativnummer: BYT-ORB587778-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMPRSS7
Konjugation: Unconjugated
Rabbit polyclonal antibody to TMPRSS7
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 78kDa
NCBI: 001036040
UniProt: Q7RTY8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LPEYRQKESREFLSVSRTVQQVINLVYTTSAFSKFYEQSVVADVSNNKGG
Target-Kategorie: TMPRSS7