ZBED5 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587807
Artikelname: ZBED5 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587807
Hersteller Artikelnummer: orb587807
Alternativnummer: BYT-ORB587807-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZBED5
Konjugation: Unconjugated
Alternative Synonym: Buster1
Rabbit polyclonal antibody to ZBED5
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 76kDa
NCBI: 005253097
UniProt: Q49AG3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SRVKFISNSNKITFSKKPKRRKYDESYLSFGFTYFGNRDAPHAQCVLCKK
Target-Kategorie: ZBED5