ZDHHC20 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB587808
| Artikelname: |
ZDHHC20 antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB587808 |
| Hersteller Artikelnummer: |
orb587808 |
| Alternativnummer: |
BYT-ORB587808-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of human ZDHHC20 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
DHHC20, DHHC-20, 4933421L13Rik |
| Rabbit polyclonal antibody to ZDHHC20 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
32kDa |
| NCBI: |
001273567 |
| UniProt: |
B4DRN8 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: IFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSAS |
| Target-Kategorie: |
ZDHHC20 |
