ZDHHC20 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587809
Artikelname: ZDHHC20 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587809
Hersteller Artikelnummer: orb587809
Alternativnummer: BYT-ORB587809-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZDHHC20
Konjugation: Unconjugated
Alternative Synonym: DHHC20, DHHC-20, 4933421L13Rik
Rabbit polyclonal antibody to ZDHHC20
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 40kDa
UniProt: Q5W0Z9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGI
Target-Kategorie: ZDHHC20