ZNF772 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587813
Artikelname: ZNF772 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587813
Hersteller Artikelnummer: orb587813
Alternativnummer: BYT-ORB587813-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF772
Konjugation: Unconjugated
Rabbit polyclonal antibody to ZNF772
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 53kDa
UniProt: Q68DY9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SFVTGEACKDFLASSSIFEHHAPHNEWKPHSNTKCEEASHCGKRHYKCSE
Target-Kategorie: ZNF772