SPATA48 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587820
Artikelname: SPATA48 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587820
Hersteller Artikelnummer: orb587820
Alternativnummer: BYT-ORB587820-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human C7orf72
Konjugation: Unconjugated
Alternative Synonym: C7orf72
Rabbit polyclonal antibody to SPATA48
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 48kDa
UniProt: A4D263
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PHYCDLLRKMNMPFVKGLENRHNYGRFEKKCNPAFLKFHPYPPSVLPDYH
Target-Kategorie: SPATA48