SOHLH2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587821
Artikelname: SOHLH2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587821
Hersteller Artikelnummer: orb587821
Alternativnummer: BYT-ORB587821-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOHLH2
Konjugation: Unconjugated
Alternative Synonym: TEB1, SOSF2, SPATA28, bHLHe81
Rabbit polyclonal antibody to SOHLH2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 55kDa
UniProt: Q9NX45
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: ALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENL
Target-Kategorie: SOHLH2