LGALS9 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587841
Artikelname: LGALS9 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587841
Hersteller Artikelnummer: orb587841
Alternativnummer: BYT-ORB587841-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LGALS9
Konjugation: Unconjugated
Alternative Synonym: HUAT, LGALS9A
Rabbit polyclonal antibody to LGALS9
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 35kDa
UniProt: O00182
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFV
Target-Kategorie: LGALS9