ZNF90 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587850
Artikelname: ZNF90 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587850
Hersteller Artikelnummer: orb587850
Alternativnummer: BYT-ORB587850-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF90
Konjugation: Unconjugated
Alternative Synonym: HTF9
Rabbit polyclonal antibody to ZNF90
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 66kDa
NCBI: 009069
UniProt: Q03938
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: CQECDKVFKRSSALSTHKIIHSGEKPYKCEECGKAFKRSSNLTTHKISHT
Target-Kategorie: ZNF90