ZNF197 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587854
Artikelname: ZNF197 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587854
Hersteller Artikelnummer: orb587854
Alternativnummer: BYT-ORB587854-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF197
Konjugation: Unconjugated
Alternative Synonym: P18, VHLaK, ZNF20, ZNF166, ZKSCAN9, ZSCAN41, D3S1363E
Rabbit polyclonal antibody to ZNF197
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 33kDa
NCBI: 001020026
UniProt: O14709
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PHKCNECGKSFCRLSHLIQHQRTHSGEKPYECEECGKSFSRSSHLAQHQR
Target-Kategorie: ZNF197