ALAS1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587863
Artikelname: ALAS1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587863
Hersteller Artikelnummer: orb587863
Alternativnummer: BYT-ORB587863-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALAS1
Konjugation: Unconjugated
Alternative Synonym: ALAS, MIG4, ALAS3, ALASH, ALAS-H
Rabbit polyclonal antibody to ALAS1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 70kDa
NCBI: 005265002
UniProt: P13196
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGH
Target-Kategorie: ALAS1