NFATC3 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587871
Artikelname: NFATC3 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587871
Hersteller Artikelnummer: orb587871
Alternativnummer: BYT-ORB587871-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NFATC3
Konjugation: Unconjugated
Alternative Synonym: NFAT4, NFATX, NF-AT4c
Rabbit polyclonal antibody to NFATC3
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 81kDa
UniProt: Q12968
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQE
Target-Kategorie: NFATC3