SCD5 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587872
Artikelname: SCD5 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587872
Hersteller Artikelnummer: orb587872
Alternativnummer: BYT-ORB587872-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SCD5
Konjugation: Unconjugated
Alternative Synonym: SCD2, SCD4, ACOD4, FADS4, HSCD5, DFNA79
Rabbit polyclonal antibody to SCD5
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 28kDa
NCBI: 079182
UniProt: Q86SK9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: HRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLL
Target-Kategorie: SCD5