ANO1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587875
Artikelname: ANO1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587875
Hersteller Artikelnummer: orb587875
Alternativnummer: BYT-ORB587875-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANO1
Konjugation: Unconjugated
Alternative Synonym: DOG1, TAOS2, ORAOV2, TMEM16A
Rabbit polyclonal antibody to ANO1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 108kDa
NCBI: 060513
UniProt: Q5XXA6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPS
Target-Kategorie: ANO1