LRRN3 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587876
Artikelname: LRRN3 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587876
Hersteller Artikelnummer: orb587876
Alternativnummer: BYT-ORB587876-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LRRN3
Konjugation: Unconjugated
Alternative Synonym: NLRR3, NLRR-3, FIGLER5
Rabbit polyclonal antibody to LRRN3
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 77kDa
NCBI: 060804
UniProt: Q9H3W5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: KNRKKCVNVTTKGLHPDQKEYEKNNTTTLMACLGGLLGIIGVICLISCLS
Target-Kategorie: LRRN3