Rad51 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587879
Artikelname: Rad51 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587879
Hersteller Artikelnummer: orb587879
Alternativnummer: BYT-ORB587879-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAD51
Konjugation: Unconjugated
Alternative Synonym: RECA, BRCC5, FANCR, MRMV2, HRAD51, RAD51A, HsRad51, HsT16930
Rabbit polyclonal antibody to Rad51
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 30kDa
UniProt: Q06609
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: DYSGRGELSARQMHLARFLRMLLRLADEIVSEERKRGNQNLQNLRLSLSS
Target-Kategorie: RAD51