TERT antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587884
Artikelname: TERT antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587884
Hersteller Artikelnummer: orb587884
Alternativnummer: BYT-ORB587884-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TERT
Konjugation: Unconjugated
Alternative Synonym: TP2, TRT, CMM9, EST2, TCS1, hTRT, DKCA2, DKCB4, hEST2, PFBMFT1
Rabbit polyclonal antibody to TERT
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 88kDa
UniProt: O14746
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSL
Target-Kategorie: TERT