DTNA antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587885
Artikelname: DTNA antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587885
Hersteller Artikelnummer: orb587885
Alternativnummer: BYT-ORB587885-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DTNA
Konjugation: Unconjugated
Alternative Synonym: DTN, DRP3, DTN-A, LVNC1, D18S892E
Rabbit polyclonal antibody to DTNA
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 40kDa
UniProt: Q9Y4J8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: DMVTEDADPYVQPEDENYENDSVRQLENELQMEEYLKQKLQDEAYQVSLQ
Target-Kategorie: DTNA