Caspase 8 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587886
Artikelname: Caspase 8 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587886
Hersteller Artikelnummer: orb587886
Alternativnummer: BYT-ORB587886-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CASP8
Konjugation: Unconjugated
Alternative Synonym: CAP4, MACH, MCH5, FLICE, ALPS2B, Casp-8
Rabbit polyclonal antibody to Caspase 8
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 43kDa
UniProt: Q14790
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKL
Target-Kategorie: CASP8