CASP9 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587888
Artikelname: CASP9 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587888
Hersteller Artikelnummer: orb587888
Alternativnummer: BYT-ORB587888-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CASP9
Konjugation: Unconjugated
Alternative Synonym: MCH6, APAF3, APAF-3, PPP1R56, ICE-LAP6
Rabbit polyclonal antibody to CASP9
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 29kDa
UniProt: P55211
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: QKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSD
Target-Kategorie: CASP9