MAP2 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587889
Artikelname: MAP2 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587889
Hersteller Artikelnummer: orb587889
Alternativnummer: BYT-ORB587889-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAP2
Konjugation: Unconjugated
Alternative Synonym: MAP-2, MAP2A, MAP2B, MAP2C
Rabbit polyclonal antibody to MAP2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 200kDa
UniProt: P11137
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: TPSTAEPSDQKEKESEKQSKPGEDLKHAALVSQPETTKTYPDKKDMQGTE
Target-Kategorie: MAP2