GSS antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587892
Artikelname: GSS antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587892
Hersteller Artikelnummer: orb587892
Alternativnummer: BYT-ORB587892-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GSS
Konjugation: Unconjugated
Alternative Synonym: GSHS, HEL-S-64p, HEL-S-88n
Rabbit polyclonal antibody to GSS
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 52kDa
NCBI: 005260463
UniProt: P48637
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EEGDQAIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERAS
Target-Kategorie: GSS