FASN antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587902
Artikelname: FASN antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587902
Hersteller Artikelnummer: orb587902
Alternativnummer: BYT-ORB587902-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FASN
Konjugation: Unconjugated
Alternative Synonym: FAS, OA-519, SDR27X1
Rabbit polyclonal antibody to FASN
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 276kDa
NCBI: 004095
UniProt: P49327
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SENGNLVVSGKVYQWDDPDPRLFDHPESPTPNPTEPLFLAQAEVYKELRL
Target-Kategorie: FASN