CDC16 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587906
Artikelname: CDC16 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587906
Hersteller Artikelnummer: orb587906
Alternativnummer: BYT-ORB587906-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDC16
Konjugation: Unconjugated
Alternative Synonym: APC6, CUT9, ANAPC6, CDC16Hs
Rabbit polyclonal antibody to CDC16
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 62kDa
UniProt: Q13042
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWE
Target-Kategorie: CDC16