MALT1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587908
Artikelname: MALT1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587908
Hersteller Artikelnummer: orb587908
Alternativnummer: BYT-ORB587908-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MALT1
Konjugation: Unconjugated
Alternative Synonym: MLT, MLT1, IMD12, PCASP1
Rabbit polyclonal antibody to MALT1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 90kDa
UniProt: Q9UDY8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: YWCHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQ
Target-Kategorie: MALT1