MATK antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587909
Artikelname: MATK antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587909
Hersteller Artikelnummer: orb587909
Alternativnummer: BYT-ORB587909-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MATK
Konjugation: Unconjugated
Alternative Synonym: CHK, CTK, HYL, Lsk, HYLTK, HHYLTK
Rabbit polyclonal antibody to MATK
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 55kDa
NCBI: 647612
UniProt: P42679
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP
Target-Kategorie: MATK