HIP1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587910
Artikelname: HIP1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587910
Hersteller Artikelnummer: orb587910
Alternativnummer: BYT-ORB587910-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human HIP1
Konjugation: Unconjugated
Alternative Synonym: SHON, HIP-I, ILWEQ, SHONbeta, SHONgamma
Rabbit polyclonal antibody to HIP1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 108kDa
UniProt: O00291
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGL
Target-Kategorie: HIP1