OAS1 antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587912
Artikelname: OAS1 antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587912
Hersteller Artikelnummer: orb587912
Alternativnummer: BYT-ORB587912-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OAS1
Konjugation: Unconjugated
Alternative Synonym: OIAS, IFI-4, OIASI, E18/E16
Rabbit polyclonal antibody to OAS1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 44kDa
NCBI: 058132
UniProt: P00973
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: AESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWT
Target-Kategorie: OAS1