FANCC antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB587919
Artikelname: FANCC antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB587919
Hersteller Artikelnummer: orb587919
Alternativnummer: BYT-ORB587919-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FANCC
Konjugation: Unconjugated
Alternative Synonym: FA3, FAC, FACC
Rabbit polyclonal antibody to FANCC
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 61kDa
NCBI: 001230672
UniProt: Q00597
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: INKEPQNSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYP
Target-Kategorie: FANCC