Human TMPRSS2 protein

Artikelnummer: BYT-ORB604423
Artikelname: Human TMPRSS2 protein
Artikelnummer: BYT-ORB604423
Hersteller Artikelnummer: orb604423
Alternativnummer: BYT-ORB604423-20,BYT-ORB604423-100,BYT-ORB604423-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: D16Ertd61e, Epitheliasin, FLJ41954, MGC6821, PP9284, PRSS10, Serine protease 10, TMPRSS2, TMPRSS2 ERG FUSION GENE, INCLUDED, TMPRSS2 ETV1 FUSION GENE, INCLUDED, TMPS2_HUMAN, Transmembrane protease serine 2 catalytic chain, Transmembrane protease, serine
Recombinant Human Transmembrane protease serine 2(TMPRSS2),partial
Molekulargewicht: 46.9 kDa
UniProt: O15393
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
Anwendungsbeschreibung: Partial